Source code for conkit.io.tests.test_plmdca

"""Testing facility for conkit.io.PlmDCAIO"""

__author__ = "Felix Simkovic"
__date__ = "26 Oct 2016"

import os
import unittest

from conkit.core.contact import Contact
from conkit.core.contactfile import ContactFile
from conkit.core.contactmap import ContactMap
from conkit.core.sequence import Sequence
from conkit.io.plmdca import PlmDCAParser
from conkit.io.tests.helpers import ParserTestCase


[docs]class TestPlmDCAParser(ParserTestCase):
[docs] def test_read_1(self): content = """1,2,0.12212 1,3,0.14004 1,4,0.12926 1,5,0.089211 1,6,0.079976 1,7,0.078954 1,8,0.052275 1,9,0.026012 1,10,0.049844 1,11,0.045109 """ f_name = self.tempfile(content=content) with open(f_name, "r") as f_in: contact_file = PlmDCAParser().read(f_in) contact_map1 = contact_file.top_map self.assertEqual(1, len(contact_file)) self.assertEqual(10, len(contact_map1)) self.assertEqual([1, 1, 1, 1, 1, 1, 1, 1, 1, 1], [c.res1_seq for c in contact_map1]) self.assertEqual([2, 3, 4, 5, 6, 7, 8, 9, 10, 11], [c.res2_seq for c in contact_map1]) self.assertEqual( [0.12212, 0.14004, 0.12926, 0.089211, 0.079976, 0.078954, 0.052275, 0.026012, 0.049844, 0.045109], [c.raw_score for c in contact_map1], )
[docs] def test_write_1(self): contact_file = ContactFile("RR") contact_file.target = "R9999" contact_file.author = "1234-5678-9000" contact_file.remark = ["Predictor remarks"] contact_file.method = ["Description of methods used", "Description of methods used"] contact_map = ContactMap("1") contact_file.add(contact_map) for c in [(1, 9, 0, 8, 0.7), (1, 10, 0, 8, 0.7), (2, 8, 0, 8, 0.9), (3, 12, 0, 8, 0.4)]: contact = Contact(c[0], c[1], c[4], distance_bound=(c[2], c[3])) contact_map.add(contact) contact_map.sequence = Sequence("1", "HLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSD") contact_map.set_sequence_register() f_name = self.tempfile() with open(f_name, "w") as f_out: PlmDCAParser().write(f_out, contact_file) content = ["1,9,0.700000", "1,10,0.700000", "2,8,0.900000", "3,12,0.400000"] with open(f_name, "r") as f_in: output = f_in.read().splitlines() self.assertEqual(content, output)
if __name__ == "__main__": unittest.main(verbosity=2)