Source code for conkit.io.tests.test_evfold

"""Testing facility for conkit.io.EVfold"""

__author__ = "Felix Simkovic"
__date__ = "26 Oct 2016"

import os
import unittest

from conkit.core.contact import Contact
from conkit.core.contactfile import ContactFile
from conkit.core.contactmap import ContactMap
from conkit.core.sequence import Sequence
from conkit.io.evfold import EVfoldParser
from conkit.io.tests.helpers import ParserTestCase


[docs]class TestEVfoldParser(ParserTestCase):
[docs] def test_read_1(self): content = """1 M 2 V 0 0.0338619 1 M 3 G 0 0.0307956 1 M 4 L 0 0.0268079 1 M 5 T 0 0.0219783 1 M 6 T 0 0.0222061 1 M 7 L 0 0.0213079 1 M 8 F 0 0.0119054 1 M 9 W 0 0.0275182 1 M 10 L 0 0.0134577 1 M 11 G 0 0.0234555 """ f_name = self.tempfile(content=content) with open(f_name, "r") as f_in: contact_file = EVfoldParser().read(f_in) contact_map1 = contact_file.top_map self.assertEqual(1, len(contact_file)) self.assertEqual(10, len(contact_map1)) self.assertEqual([1, 1, 1, 1, 1, 1, 1, 1, 1, 1], [c.res1_seq for c in contact_map1]) self.assertEqual([2, 3, 4, 5, 6, 7, 8, 9, 10, 11], [c.res2_seq for c in contact_map1]) self.assertEqual( [ 0.0338619, 0.0307956, 0.0268079, 0.0219783, 0.0222061, 0.0213079, 0.0119054, 0.0275182, 0.0134577, 0.0234555, ], [c.raw_score for c in contact_map1], )
[docs] def test_write_1(self): contact_file = ContactFile("RR") contact_file.target = "R9999" contact_file.author = "1234-5678-9000" contact_file.remark = ["Predictor remarks"] contact_file.method = ["Description of methods used", "Description of methods used"] contact_map = ContactMap("1") contact_file.add(contact_map) for c in [(1, 9, 0, 8, 0.7), (1, 10, 0, 8, 0.7), (2, 8, 0, 8, 0.9), (3, 12, 0, 8, 0.4)]: contact = Contact(c[0], c[1], c[4], distance_bound=(c[2], c[3])) contact_map.add(contact) contact_map.sequence = Sequence("1", "HLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSD") contact_map.set_sequence_register() f_name = self.tempfile() with open(f_name, "w") as f_out: EVfoldParser().write(f_out, contact_file) content = ["1 H 9 L 0 0.7", "1 H 10 L 0 0.7", "2 L 8 I 0 0.9", "3 E 12 K 0 0.4"] with open(f_name, "r") as f_in: output = f_in.read().splitlines() self.assertEqual(content, output)
if __name__ == "__main__": unittest.main(verbosity=2)