Source code for conkit.io.tests.test_epcmap

"""Testing facility for conkit.io.EPCMapIO"""

__author__ = "Felix Simkovic"
__date__ = "12 Dec 2016"

import os
import unittest

from conkit.core.contact import Contact
from conkit.core.contactfile import ContactFile
from conkit.core.contactmap import ContactMap
from conkit.core.sequence import Sequence
from conkit.io.epcmap import EPCMapParser
from conkit.io.tests.helpers import ParserTestCase


[docs]class TestEPCMapParser(ParserTestCase):
[docs] def test_read_1(self): content = """46 78 0 8 9.301869 80 105 0 8 8.856009 111 129 0 8 7.252451 75 205 0 8 6.800462 19 44 0 8 6.588349 111 130 0 8 6.184269 23 41 0 8 6.163786 171 205 0 8 5.519271 53 126 0 8 5.440612 100 140 0 8 5.382865 """ f_name = self.tempfile(content=content) with open(f_name, "r") as f_in: contact_file = EPCMapParser().read(f_in) contact_map1 = contact_file.top_map self.assertEqual(1, len(contact_file)) self.assertEqual(10, len(contact_map1)) self.assertEqual([46, 80, 111, 75, 19, 111, 23, 171, 53, 100], [c.res1_seq for c in contact_map1]) self.assertEqual([78, 105, 129, 205, 44, 130, 41, 205, 126, 140], [c.res2_seq for c in contact_map1]) self.assertEqual( [9.301869, 8.856009, 7.252451, 6.800462, 6.588349, 6.184269, 6.163786, 5.519271, 5.440612, 5.382865], [c.raw_score for c in contact_map1], )
[docs] def test_write_1(self): contact_file = ContactFile("RR") contact_file.target = "R9999" contact_file.author = "1234-5678-9000" contact_file.remark = ["Predictor remarks"] contact_file.method = ["Description of methods used", "Description of methods used"] contact_map = ContactMap("1") contact_file.add(contact_map) for c in [(1, 9, 0, 8, 0.7), (1, 10, 0, 8, 0.7), (2, 8, 0, 8, 0.9), (3, 12, 0, 8, 0.4)]: contact = Contact(c[0], c[1], c[4], distance_bound=(c[2], c[3])) contact_map.add(contact) contact_map.sequence = Sequence("1", "HLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSD") contact_map.set_sequence_register() f_name = self.tempfile() with open(f_name, "w") as f_out: EPCMapParser().write(f_out, contact_file) content = ["1 9 0 8 0.700000", "1 10 0 8 0.700000", "2 8 0 8 0.900000", "3 12 0 8 0.400000"] with open(f_name, "r") as f_in: output = f_in.read().splitlines() self.assertEqual(content, output)
if __name__ == "__main__": unittest.main(verbosity=2)